PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_28382_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 563aa    MW: 63661.2 Da    PI: 7.9287
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_28382_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox34.92.7e-1126562656
                    -HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox 26 saeereeLAkklgLterqVkvWFqNrRakek 56
                    ++++r +L+++lgL  rq+k+WFqNrR+++k
  Neem_28382_f_1 26 DEKQRLQLSRELGLAPRQIKFWFQNRRTQMK 56
                    689*************************998 PP

2START181.45.1e-571994202206
                     HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS.......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEEEE CS
           START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv......dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                     +a  a++el+++ + +ep+W+kss    + +n + + + f+++++       ++ea+r+sgvv+m+   lv  ++d + +W e ++     a+t+
  Neem_28382_f_1 199 IAANAMEELLRLLQTNEPLWMKSSadgrDVLNLESYERMFPRANShlknpnVRIEASRDSGVVIMNGLALVDMFMDCN-KWVELFPtivsMAKTI 292
                     67889*******************9999888889999999888889999999**************************.******999999**** PP

                     EEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  83 evissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     evissg      g lqlm+ elq+lsplvp R+f+++Ry++q ++g w+iv vS d  q+ ++     R++++pSg+li++++ng+skvtwvehv
  Neem_28382_f_1 293 EVISSGmlgthsGSLQLMYEELQVLSPLVPtREFYILRYCQQIEQGLWAIVNVSYDFSQFASQ----YRSHRFPSGCLIQDMPNGYSKVTWVEHV 383
                     ************************************************************986....9*************************** PP

                     E--SSXX.HHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlp.hwllrslvksglaegaktwvatlqrqcek 206
                     ++++r p h l+r l++sgla ga +w+atlqr ce+
  Neem_28382_f_1 384 EVEDRAPlHRLYRELIQSGLALGAERWLATLQRMCER 420
                     ***********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003891.8E-5662IPR001356Homeobox domain
SuperFamilySSF466891.67E-92565IPR009057Homeodomain-like
PROSITE profilePS5007112.1632658IPR001356Homeobox domain
PfamPF000469.3E-92656IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.4E-102663IPR009057Homeodomain-like
CDDcd000862.18E-82659No hitNo description
PROSITE patternPS0002703356IPR017970Homeobox, conserved site
PROSITE profilePS5084853.346189423IPR002913START domain
SuperFamilySSF559618.24E-38190421No hitNo description
CDDcd088751.56E-120193419No hitNo description
SMARTSM002349.1E-49198420IPR002913START domain
PfamPF018522.2E-49199420IPR002913START domain
Gene3DG3DSA:3.30.530.202.8E-8261419IPR023393START-like domain
SuperFamilySSF559617.58E-9441532No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MTAPTHKGER SVTIAILLTR FRDLKDEKQR LQLSRELGLA PRQIKFWFQN RRTQMKAQHE  60
RADNCALRAE NDKIRCENIA IREALKNVIC PSCGGPPVSE DSYFDEQKLR MENTQLKEEL  120
DRVSSIAAKY IGRPISQLPP VQPIHISSLD LTMGSFGSQG IGGPSLDLDL LPGSSSNMPN  180
FPFQQIVLSD MDKSLMTDIA ANAMEELLRL LQTNEPLWMK SSADGRDVLN LESYERMFPR  240
ANSHLKNPNV RIEASRDSGV VIMNGLALVD MFMDCNKWVE LFPTIVSMAK TIEVISSGML  300
GTHSGSLQLM YEELQVLSPL VPTREFYILR YCQQIEQGLW AIVNVSYDFS QFASQYRSHR  360
FPSGCLIQDM PNGYSKVTWV EHVEVEDRAP LHRLYRELIQ SGLALGAERW LATLQRMCER  420
FACLMVSGNS TRDLGGVIPS PDGKRSMMKL AQRMVSNFCT SISTSNSHRW TTLSGLNEVG  480
VRVALHKSTD PGQPNGVVLN AATTFWLPVS PQNVFNFFKD ERTRPQSFFF LFSGTFFPMA  540
MEYKKLPTLQ MGHILATAYP FFV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006478112.10.0PREDICTED: homeobox-leucine zipper protein HDG11-like
SwissprotQ9FX310.0HDG11_ARATH; Homeobox-leucine zipper protein HDG11
TrEMBLA0A061FQZ60.0A0A061FQZ6_THECC; Homeobox-leucine zipper protein HDG11
STRINGVIT_17s0053g00780.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM30042665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73360.10.0homeodomain GLABROUS 11